1pd3/4/1:A/2:B

Sequences

>1pd3-a4-m1-cA (length=54) [Search sequence]

GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF

>1pd3-a4-m2-cB (length=54) [Search sequence]

GKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTF

Structure information

PDB ID	1pd3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Influenza A NEP M1-binding domain
Assembly ID	4
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	B
UniProt accession	P03508	P03508
Species	11320 (Influenza A virus)	11320 (Influenza A virus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1pd3-a4-m1-cA_1pd3-a4-m2-cB.pdb.gz

Full biological assembly Download: 1pd3-assembly4.cif.gz