1pe3/1/1:1/1:2

Sequences
>1pe3-a1-m1-c1 (length=59) [Search sequence]
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
>1pe3-a1-m1-c2 (length=59) [Search sequence]
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Structure information
PDB ID 1pe3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution structure of the disulphide-linked dimer of human intestinal trefoil factor (TFF3)
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 43
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 1 2
UniProt accession Q07654 Q07654
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1pe3-a1-m1-c1_1pe3-a1-m1-c2.pdb.gz
Full biological assembly
Download: 1pe3-assembly1.cif.gz

[Back to Home]