1pew/3/4:A/3:B

Sequences
>1pew-a3-m4-cA (length=108) [Search sequence]
NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQSAPITVIYEDNQRPSGVPDRF
AGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG
>1pew-a3-m3-cB (length=108) [Search sequence]
NFMLNQPHSVSESPGKTVTISCTRSSGNIASNYVQWYQQSAPITVIYEDNQRPSGVPDRF
AGSIDRSSNSASLTISGLKTEDEADYYCQSYDARNVVFGGGTRLTVLG
Structure information
PDB ID 1pew (database links: RCSB PDB PDBe PDBj PDBsum)
Title High Resolution Crystal Structure of Jto2, a mutant of the non-amyloidogenic Lamba6 Light Chain, Jto
Assembly ID 3
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 4 3
Chain ID A B
UniProt accession P01721 P01721
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1pew-a3-m4-cA_1pew-a3-m3-cB.pdb.gz
Full biological assembly
Download: 1pew-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1pew/2/1:B/2:A 1pew/2/2:B/1:A 1pew/3/1:B/2:A
Other dimers with similar sequences but different poses
  • 7lmr/1/1:B/1:A 1cd0/1/1:B/1:A 1pew/2/2:B/1:B 1pew/3/4:A/2:A 2w0k/1/1:A/2:A 2w0k/2/1:B/3:B 2w0l/1/1:C/1:A 2w0l/2/1:D/1:B 3b5g/1/1:A/1:B 3bdx/1/1:A/1:B 5c9k/10/1:B/2:H 5c9k/11/1:C/1:E 5c9k/12/1:F/1:D 5c9k/9/1:A/1:G 5jpj/1/1:A/2:A 5jpj/2/1:B/3:B 6mg4/1/1:B/1:A 6mg5/1/1:B/1:A 6w4y/1/1:B/1:A 7lmn/1/1:B/1:A 7lmo/1/1:B/1:A 7lmp/1/1:B/1:A 7lmq/1/1:B/1:A 7rtp/1/1:B/1:A
  • 1pew/2/2:B/2:A 1pew/1/1:B/1:A 1pew/2/1:A/1:B 1pew/3/2:A/3:B 1pew/3/4:A/1:B
  • 6ii4/2/3:F/5:F 6ii4/1/1:L/2:L 6ii4/1/1:L/4:L 6ii4/1/2:L/4:L 6ii4/2/1:F/3:F 6ii4/2/1:F/5:F
  • [Back to Home]