1pfb/2/1:A/2:A

Sequences
>1pfb-a2-m1-cA (length=55) [Search sequence]
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK
>1pfb-a2-m2-cA (length=55) [Search sequence]
DLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLIDIYEQTNK
Structure information
PDB ID 1pfb (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural Basis for specific binding of polycomb chromodomain to histone H3 methylated at K27
Assembly ID 2
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 12897052
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P26017 P26017
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:1pfbA BioLiP:1pfbA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1pfb-a2-m1-cA_1pfb-a2-m2-cA.pdb.gz
Full biological assembly
Download: 1pfb-assembly2.cif.gz

[Back to Home]