1pkv/1/1:A/1:B

Sequences
>1pkv-a1-m1-cA (length=87) [Search sequence]
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS
FDLMKETLRITNLGDLKVGDWVNVERA
>1pkv-a1-m1-cB (length=87) [Search sequence]
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS
FDLMKETLRITNLGDLKVGDWVNVERA
Structure information
PDB ID 1pkv (database links: RCSB PDB PDBe PDBj PDBsum)
Title The N-terminal domain of riboflavin synthase in complex with riboflavin
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 79
Sequence identity between the two chains 1.0
PubMed citation 12927541
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P0AFU8 P0AFU8
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:1pkvA BioLiP:1pkvB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1pkv-a1-m1-cA_1pkv-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1pkv-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1hze/1/1:A/1:B 1i18/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1i8d/1/1:C/1:B 1i8d/1/1:B/1:A
  • [Back to Home]