1pn4/1/1:A/1:B

Sequences

>1pn4-a1-m1-cA (length=272) [Search sequence]

PVWRFDDRDVILYNIALGATTKQLKYVYENDSDFQVIPTFGHLITFNSGKSQNSFAKLLR
NFNPMLLLHGEHYLKVHSWPPPTEGEIKTTFEPIATTPKGTNVVIVHGSKSVDNKSGELI
YSNEATYFIRNCQADNKVYADRPAFATNQFLAPKRAPDYQVDVPVSEDLAALYRLSGDRN
PLQIDPNFAKGAKFPKPILHGMCTYGLSAKALIDKFGMFNEIKARFTGIVFPGETLRVLA
WKESDDTIVFQTHVVDRGTIAINNAAIKLVGD

>1pn4-a1-m1-cB (length=272) [Search sequence]

Structure information

PDB ID	1pn4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of 2-enoyl-CoA hydratase 2 domain of Candida tropicalis multifunctional enzyme type 2 complexed with (3R)-hydroxydecanoyl-CoA.
Assembly ID	1
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0
PubMed citation	15051722

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P22414	P22414
Species	5482 (Candida tropicalis)	5482 (Candida tropicalis)
Function annotation	BioLiP:1pn4A	BioLiP:1pn4B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1pn4-a1-m1-cA_1pn4-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1pn4-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1pn2/1/1:B/1:A 1pn2/2/1:C/1:D 1pn4/2/1:C/1:D