1pyo/1/1:B/1:D

Sequences
>1pyo-a1-m1-cB (length=98) [Search sequence]
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNAL
IKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPP
>1pyo-a1-m1-cD (length=99) [Search sequence]
PKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNAL
IKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Structure information
PDB ID 1pyo (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human Caspase-2 in Complex with Acetyl-Leu-Asp-Glu-Ser-Asp-cho
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 96
Sequence identity between the two chains 1.0
PubMed citation 12920126
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P42575 P42575
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1pyoB BioLiP:1pyoD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1pyo-a1-m1-cB_1pyo-a1-m1-cD.pdb.gz
Full biological assembly
Download: 1pyo-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2p2c/1/1:B/1:D 2p2c/2/1:F/1:H 2p2c/3/1:L/1:J 3r5j/3/1:B/1:D 3r6g/3/1:B/1:D 3r6l/3/1:B/1:D 3r7b/1/1:B/1:D 3r7n/3/1:D/1:B 3r7s/3/1:D/1:B 3rjm/1/1:B/1:D

[Back to Home]