1pzq/1/1:A/1:B

Sequences
>1pzq-a1-m1-cA (length=60) [Search sequence]
GSAASPAVDIGDRLDELEKALEALSAEDGHDDVGQRLESLLRRWNSRRADAPSTSAISED
>1pzq-a1-m1-cB (length=60) [Search sequence]
GSAASPAVDIGDRLDELEKALEALSAEDGHDDVGQRLESLLRRWNSRRADAPSTSAISED
Structure information
PDB ID 1pzq (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of fused docking domains from the erythromycin polyketide synthase (DEBS), a model for the interaction between DEBS 2 and DEBS 3: The A domain
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 119
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q03132 Q03132
Species 1836 (Saccharopolyspora erythraea) 1836 (Saccharopolyspora erythraea)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1pzq-a1-m1-cA_1pzq-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1pzq-assembly1.cif.gz

[Back to Home]