1pzw/1/1:A/2:A

Sequences
>1pzw-a1-m1-cA (length=80) [Search sequence]
DICRLCLRGVSGAQMCLQIFDVDSGESKVAEVLRQHFWFEVLPNDEISKVICNVCWTQVS
EFHQFYVSIQEAQVIYATTS
>1pzw-a1-m2-cA (length=80) [Search sequence]
DICRLCLRGVSGAQMCLQIFDVDSGESKVAEVLRQHFWFEVLPNDEISKVICNVCWTQVS
EFHQFYVSIQEAQVIYATTS
Structure information
PDB ID 1pzw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the zinc finger associated domain of the Drosophila transcription factor Grauzone
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
PubMed citation 14604529
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q9U405 Q9U405
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:1pzwA BioLiP:1pzwA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1pzw-a1-m1-cA_1pzw-a1-m2-cA.pdb.gz
Full biological assembly
Download: 1pzw-assembly1.cif.gz

[Back to Home]