1q0g/2/1:K/1:L

Sequences
>1q0g-a2-m1-cK (length=117) [Search sequence]
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWS
DYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
>1q0g-a2-m1-cL (length=117) [Search sequence]
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWS
DYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Structure information
PDB ID 1q0g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after full x-ray-induced reduction
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
PubMed citation 15173586
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID K L
UniProt accession P80734 P80734
Species 73044 (Streptomyces seoulensis) 73044 (Streptomyces seoulensis)
Function annotation BioLiP:1q0gK BioLiP:1q0gL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1q0g-a2-m1-cK_1q0g-a2-m1-cL.pdb.gz
Full biological assembly
Download: 1q0g-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1q0d/1/1:A/1:B 1q0d/1/1:A/1:D 1q0d/1/1:B/1:D 1q0d/1/1:C/1:E 1q0d/1/1:C/1:F 1q0d/1/1:E/1:F 1q0d/2/1:G/1:H 1q0d/2/1:G/1:J 1q0d/2/1:H/1:J 1q0d/2/1:I/1:K 1q0d/2/1:I/1:L 1q0d/2/1:K/1:L 1q0f/1/1:A/1:B 1q0f/1/1:A/1:D 1q0f/1/1:B/1:D 1q0f/1/1:C/1:E 1q0f/1/1:C/1:F 1q0f/1/1:E/1:F 1q0f/2/1:G/1:H 1q0f/2/1:G/1:J 1q0f/2/1:H/1:J 1q0f/2/1:I/1:K 1q0f/2/1:I/1:L 1q0f/2/1:K/1:L 1q0g/1/1:A/1:B 1q0g/1/1:A/1:D 1q0g/1/1:B/1:D 1q0g/1/1:C/1:E 1q0g/1/1:C/1:F 1q0g/1/1:E/1:F 1q0g/2/1:G/1:H 1q0g/2/1:G/1:J 1q0g/2/1:H/1:J 1q0g/2/1:I/1:K 1q0g/2/1:I/1:L 1q0k/1/1:A/1:B 1q0k/1/1:A/1:D 1q0k/1/1:B/1:D 1q0k/1/1:C/1:E 1q0k/1/1:C/1:F 1q0k/1/1:E/1:F 1q0k/2/1:G/1:H 1q0k/2/1:G/1:J 1q0k/2/1:H/1:J 1q0k/2/1:I/1:K 1q0k/2/1:I/1:L 1q0k/2/1:K/1:L 1q0m/1/1:A/1:B 1q0m/1/1:A/1:D 1q0m/1/1:B/1:D 1q0m/1/1:C/1:E 1q0m/1/1:C/1:F 1q0m/1/1:E/1:F
Other dimers with similar sequences but different poses
  • 1q0g/2/1:J/1:L 1q0d/1/1:A/1:C 1q0d/1/1:B/1:E 1q0d/1/1:D/1:F 1q0d/2/1:G/1:I 1q0d/2/1:H/1:K 1q0d/2/1:J/1:L 1q0f/1/1:A/1:C 1q0f/1/1:B/1:E 1q0f/1/1:D/1:F 1q0f/2/1:G/1:I 1q0f/2/1:H/1:K 1q0f/2/1:J/1:L 1q0g/1/1:A/1:C 1q0g/1/1:B/1:E 1q0g/1/1:D/1:F 1q0g/2/1:G/1:I 1q0g/2/1:H/1:K 1q0k/1/1:A/1:C 1q0k/1/1:B/1:E 1q0k/1/1:D/1:F 1q0k/2/1:G/1:I 1q0k/2/1:H/1:K 1q0k/2/1:J/1:L 1q0m/1/1:A/1:C 1q0m/1/1:B/1:E 1q0m/1/1:D/1:F
  • 1q0g/2/1:G/1:L 1q0d/1/1:A/1:F 1q0d/1/1:B/1:C 1q0d/1/1:D/1:E 1q0d/2/1:G/1:L 1q0d/2/1:H/1:I 1q0d/2/1:J/1:K 1q0f/1/1:A/1:F 1q0f/1/1:B/1:C 1q0f/1/1:D/1:E 1q0f/2/1:G/1:L 1q0f/2/1:H/1:I 1q0f/2/1:J/1:K 1q0g/1/1:A/1:F 1q0g/1/1:B/1:C 1q0g/1/1:D/1:E 1q0g/2/1:H/1:I 1q0g/2/1:J/1:K 1q0k/1/1:A/1:F 1q0k/1/1:B/1:C 1q0k/1/1:D/1:E 1q0k/2/1:G/1:L 1q0k/2/1:H/1:I 1q0k/2/1:J/1:K 1q0m/1/1:A/1:F 1q0m/1/1:B/1:C 1q0m/1/1:D/1:E
  • [Back to Home]