1q6b/1/1:A/1:B

Sequences
>1q6b-a1-m1-cA (length=107) [Search sequence]
AMARMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIH
VELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV
>1q6b-a1-m1-cB (length=107) [Search sequence]
AMARMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIH
VELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV
Structure information
PDB ID 1q6b (database links: RCSB PDB PDBe PDBj PDBsum)
Title Solution Structure of the C-terminal Domain of Thermosynechococcus elongatus KaiA (ThKaiA180C); Ensemble of 25 Structures
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 45
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q79V62 Q79V62
Species 197221 (Thermosynechococcus vestitus BP-1) 197221 (Thermosynechococcus vestitus BP-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1q6b-a1-m1-cA_1q6b-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1q6b-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1q6a/1/1:A/1:B 1suy/1/1:A/1:B 1sv1/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 5jwr/2/1:G/1:H 1v2z/1/1:A/2:A 5jwr/1/1:E/1:F
  • [Back to Home]