1qey/1/1:C/1:D

Sequences
>1qey-a1-m1-cC (length=31) [Search sequence]
RNDAERLADEQSELVKKMVFDTLKDLYKKTT
>1qey-a1-m1-cD (length=31) [Search sequence]
RNDAERLADEQSELVKKMVFDTLKDLYKKTT
Structure information
PDB ID 1qey (database links: RCSB PDB PDBe PDBj PDBsum)
Title NMR Structure Determination of the Tetramerization Domain of the MNT Repressor: An Asymmetric A-Helical Assembly in Slow Exchange
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 64
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P03049 P03049
Species 10754 (Lederbergvirus P22) 10754 (Lederbergvirus P22)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1qey-a1-m1-cC_1qey-a1-m1-cD.pdb.gz
Full biological assembly
Download: 1qey-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1qey/1/1:B/1:D 1qey/1/1:A/1:C
  • 1qey/1/1:A/1:D 1qey/1/1:B/1:C
  • [Back to Home]