1qmo/1/1:C/1:D

Sequences

>1qmo-a1-m1-cC (length=113) [Search sequence]

AQSLSFSFTKFDPNQEDLIFQGHATSTNNVLQVTKLDSAGNPVSSSAGRVLYSAPLRLWE DSAVLTSFDTIINFEISTPYTSRIADGLAFFIAPPDSVISYHGGFLGLFPNAN

>1qmo-a1-m1-cD (length=113) [Search sequence]

AQSLSFSFTKFDPNQEDLIFQGHATSTNNVLQVTKLDSAGNPVSSSAGRVLYSAPLRLWE DSAVLTSFDTIINFEISTPYTSRIADGLAFFIAPPDSVISYHGGFLGLFPNAN

Structure information

PDB ID	1qmo (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of FRIL, a legume lectin that delays hematopoietic progenitor maturation
Assembly ID	1
Resolution	3.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	65
Sequence identity between the two chains	1.0
PubMed citation	10843844

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q9ZTA9	Q9ZTA9
Species	35936 (Lablab purpureus)	35936 (Lablab purpureus)
Function annotation	BioLiP:1qmoC	BioLiP:1qmoD

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1qmo-a1-m1-cC_1qmo-a1-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1qmo-assembly1.cif.gz

Similar dimers