1qnw/1/1:C/1:D

Sequences

>1qnw-a1-m1-cC (length=236) [Search sequence]

SDDLSFNFDKFVPNQKNIIFQGDASVSTTGVLQVTKVSKPTTTSIGRALYAAPIQIWDSI
TGKVASFATSFSFVVKADKSDGVDGLAFFLAPANSQIPSGSSAGMFGLFSSSDSKSSNQI
IAVEFDTYFGKAYNPWDPDFKHIGIDVNSIKSIKTVKWDWRNGEVADVVITYRAPTKSLT
VCLSYPSDGTSNIITASVDLKAILPEWVSVGFSGGVGNAAEFETHDVLSWYFTSNL

>1qnw-a1-m1-cD (length=236) [Search sequence]

Structure information

PDB ID	1qnw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	lectin II from Ulex europaeus
Assembly ID	1
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0
PubMed citation	10966800

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	P22973	P22973
Species	3902 (Ulex europaeus)	3902 (Ulex europaeus)
Function annotation	BioLiP:1qnwC	BioLiP:1qnwD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1qnw-a1-m1-cC_1qnw-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1qnw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1dzq/1/1:A/1:B 1dzq/1/1:C/1:D 1qnw/1/1:A/1:B 1qoo/1/1:A/1:B 1qoo/1/1:C/1:D 1qos/1/1:A/2:B 1qos/1/1:B/2:A 1qot/1/1:A/1:B 1qot/1/1:C/1:D
Other dimers with similar sequences but different poses	1qnw/1/1:B/1:D 1dzq/1/1:A/1:C 1dzq/1/1:B/1:D 1qnw/1/1:A/1:C 1qoo/1/1:A/1:C 1qoo/1/1:B/1:D 1qos/1/1:A/1:B 1qos/1/2:A/2:B 1qot/1/1:A/1:C 1qot/1/1:B/1:D