1qvw/1/1:A/1:B

Sequences

>1qvw-a1-m1-cA (length=235) [Search sequence]

APKKVLLALTSYNDVFYSDGMKTGVFVVEALHPFNTFRKEGFEVDFVSETGKFGWDEHSL
AKDFLNGQDETDFKNKDSDFNKTLAKIKTPKEVNADDYQIFMASAGHGTLFDYPKAKDLQ
DIASEIYANGGVVAAVHGPAMFDGLTDKKTGRPLIEGKSITGFTDVGETIMGVDSILKAK
NLATVEDVAKKYGAKYLAPVGPWDDYSITDGRLVTGVNPASAHSTAVRSIDALKN

>1qvw-a1-m1-cB (length=235) [Search sequence]

Structure information

PDB ID	1qvw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the S. cerevisiae YDR533c protein
Assembly ID	1
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	26
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q04432	Q04432
Species	4932 (Saccharomyces cerevisiae)	4932 (Saccharomyces cerevisiae)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1qvw-a1-m1-cA_1qvw-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1qvw-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1qvv/1/1:A/2:D 1qvv/2/3:C/1:B 1qvz/1/1:A/1:B 4qyx/1/1:A/2:A