1qx2/5/1:B/1:A

Sequences

>1qx2-a5-m1-cB (length=74) [Search sequence]

KSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGE VSFEEFLVMMKKIS

>1qx2-a5-m1-cA (length=75) [Search sequence]

KSPEEIKGAFEVFAAKEGDPNQISKEELKLVMQTLGPSLLKGMSTLDEMIEEVDKNGDGE VSFEEFLVMMKKISQ

Structure information

PDB ID	1qx2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	X-ray Structure of Calcium-loaded Calbindomodulin (A Calbindin D9k Re-engineered to Undergo a Conformational Opening) at 1.44 A Resolution
Assembly ID	5
Resolution	1.44Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	15137763

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P02633	P02633
Species	9913 (Bos taurus)	9913 (Bos taurus)
Function annotation	BioLiP:1qx2B	BioLiP:1qx2A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1qx2-a5-m1-cB_1qx2-a5-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1qx2-assembly5.cif.gz

Similar dimers