1qx8/1/1:A/2:B

Sequences
>1qx8-a1-m1-cA (length=47) [Search sequence]
EKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF
>1qx8-a1-m2-cB (length=51) [Search sequence]
MTKQEKTALNMARFIRSQTLTLLEKLNELADICESLHDHADELYRSCLARF
Structure information
PDB ID 1qx8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a five-residue deletion mutant of the Rop protein
Assembly ID 1
Resolution 2.02Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P03051 P03051
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1qx8-a1-m1-cA_1qx8-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1qx8-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1gmg/2/1:B/3:B 1gmg/1/1:A/2:A
  • 1nkd/1/1:A/2:A 1gto/1/1:A/2:A 1gto/2/1:B/1:C 1rop/1/1:A/2:A 1rpo/1/1:A/2:A 1rpr/1/1:A/1:B 2ghy/1/1:A/1:B 2ijh/1/1:A/1:B 2ijh/2/1:C/2:C 2iji/1/1:A/2:A 2ijj/1/1:B/1:A 2ijj/2/1:C/2:C 2ijk/1/1:A/1:B 3k79/1/1:A/2:A 4do2/1/1:A/1:B 7kae/1/1:B/1:A
  • 1qx8/1/1:B/2:B 1qx8/1/1:A/2:A
    		•

    [Back to Home]