1r1s/5/1:A/1:E

Sequences

>1r1s-a5-m1-cA (length=96) [Search sequence]

DIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDT KGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD

>1r1s-a5-m1-cE (length=99) [Search sequence]

SFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVM RDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRD

Structure information

PDB ID	1r1s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural Basis for Differential Recognition of Tyrosine Phosphorylated Sites in the Linker for Activation of T cells (LAT) by the Adaptor Protein Gads
Assembly ID	5
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	67
Sequence identity between the two chains	1.0
PubMed citation	15029250

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	E
UniProt accession	O89100	O89100
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:1r1sA	BioLiP:1r1sE

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1r1s-a5-m1-cA_1r1s-a5-m1-cE.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1r1s-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1r1q/3/2:A/1:B 1r1s/6/1:C/1:G