1r4a/1/1:F/1:H

Sequences
>1r4a-a1-m1-cF (length=51) [Search sequence]
PTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMF
>1r4a-a1-m1-cH (length=51) [Search sequence]
PTEFEYLRKVLFEYMMGRETKTMAKVITTVLKFPDDQTQKILEREDARLMF
Structure information
PDB ID 1r4a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 36
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F H
UniProt accession Q13439 Q13439
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1r4a-a1-m1-cF_1r4a-a1-m1-cH.pdb.gz
Full biological assembly
Download: 1r4a-assembly1.cif.gz
Similar dimers

[Back to Home]