1r8h/7/1:C/1:D

Sequences
>1r8h-a7-m1-cC (length=83) [Search sequence]
SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKHAIVTVTYHSEEQRQQ
FLNVVKIPPTIRHKLGFMSMHLL
>1r8h-a7-m1-cD (length=87) [Search sequence]
SSATPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHKHAIVTVTYHSEE
QRQQFLNVVKIPPTIRHKLGFMSMHLL
Structure information
PDB ID 1r8h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Comparison of the structure and DNA binding properties of the E2 proteins from an oncogenic and a non-oncogenic human papillomavirus
Assembly ID 7
Resolution 1.9Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 70
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q84294 Q84294
Species 37122 (Human papillomavirus type 6a) 37122 (Human papillomavirus type 6a)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1r8h-a7-m1-cC_1r8h-a7-m1-cD.pdb.gz
Full biological assembly
Download: 1r8h-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1r8h/4/1:A/1:B 1r8h/4/1:C/1:D 1r8h/4/1:F/1:E 1r8h/5/1:B/1:A 1r8h/6/1:F/1:E 2ayb/1/1:B/1:A 2aye/1/1:A/1:B 2aye/2/1:D/1:C 2aye/3/1:F/1:E 2aye/4/1:A/1:B 2aye/4/2:F/2:E 2aye/4/3:D/3:C 2ayg/1/1:B/1:A
Other dimers with similar sequences but different poses
  • 1r8h/4/1:B/1:E 1r8h/1/1:D/1:A 1r8h/2/1:E/1:B 1r8h/3/1:F/1:C 1r8h/4/1:D/1:A 1r8h/4/1:F/1:C 2aye/4/1:A/2:E 2aye/4/2:F/3:C 2aye/4/3:D/1:B
  • [Back to Home]