1r94/1/1:B/2:B

Sequences
>1r94-a1-m1-cB (length=97) [Search sequence]
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGV
KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKD
>1r94-a1-m2-cB (length=97) [Search sequence]
MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGV
KVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKD
Structure information
PDB ID 1r94 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of IscA (MERCURY DERIVATIVE)
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 75
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P0AAC8 P0AAC8
Species 562 (Escherichia coli) 562 (Escherichia coli)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1r94-a1-m1-cB_1r94-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1r94-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1r94/1/1:A/2:A 1r95/1/1:A/2:A 1r95/1/1:B/2:B 1s98/1/1:A/1:B 1s98/1/2:A/2:B
Other dimers with similar sequences but different poses
  • 1r94/1/2:A/2:B 1r94/1/1:A/1:B 1r95/1/1:A/1:B 1r95/1/2:A/2:B
  • 1s98/1/1:A/2:B 1s98/1/1:B/2:A
    		•

    [Back to Home]