1rgx/2/2:A/2:B

Sequences
>1rgx-a2-m2-cA (length=89) [Search sequence]
CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSW
DIREEKVCHCQCARIDWTAARCCKLQVAS
>1rgx-a2-m2-cB (length=89) [Search sequence]
CPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSW
DIREEKVCHCQCARIDWTAARCCKLQVAS
Structure information
PDB ID 1rgx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of resisitin
Assembly ID 2
Resolution 1.787Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 78
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession Q99P87 Q99P87
Species 10090 (Mus musculus) 10090 (Mus musculus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1rgx-a2-m2-cA_1rgx-a2-m2-cB.pdb.gz
Full biological assembly
Download: 1rgx-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1rfx/1/1:A/1:B 1rfx/1/1:A/1:C 1rfx/2/1:A/1:B 1rfx/2/1:A/1:C 1rfx/2/2:A/2:B 1rfx/2/2:A/2:C 1rgx/1/1:A/1:B 1rgx/1/1:A/1:C 1rgx/1/1:B/1:C 1rgx/2/1:A/1:B 1rgx/2/1:A/1:C 1rgx/2/1:B/1:C 1rgx/2/2:A/2:C 1rgx/2/2:B/2:C
Other dimers with similar sequences but different poses
  • 1rfx/3/2:B/2:C 1rfx/1/1:B/1:C 1rfx/2/1:B/1:C 1rfx/2/2:B/2:C 1rfx/3/1:B/1:C
  • 1rgx/2/1:B/2:C 1rfx/2/1:A/2:A 1rgx/2/1:A/2:A 1rgx/2/2:B/1:C
  • 1rgx/2/1:A/2:C 1rfx/2/1:A/2:C 1rfx/2/1:C/2:A 1rgx/2/1:B/2:B 1rgx/2/2:A/1:C
  • 1rfx/3/1:B/2:B 1rfx/2/1:B/2:B
  • 1rfx/3/1:B/2:C 1rfx/2/1:B/2:C 1rfx/2/1:C/2:B 1rfx/3/1:C/2:B
  • 1rfx/3/1:B/4:A 1rfx/3/2:B/3:A
  • [Back to Home]