1s1c/1/1:X/1:Y

Sequences

>1s1c-a1-m1-cX (length=69) [Search sequence]

GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVN KLAEIMNRK

>1s1c-a1-m1-cY (length=70) [Search sequence]

GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVN KLAEIMNRKD

Structure information

PDB ID	1s1c (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI
Assembly ID	1
Resolution	2.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	77
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	X	Y
UniProt accession	Q13464	Q13464
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1s1c-a1-m1-cX_1s1c-a1-m1-cY.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1s1c-assembly1.cif.gz