1s1c/1/1:X/1:Y

Sequences
>1s1c-a1-m1-cX (length=69) [Search sequence]
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVN
KLAEIMNRK
>1s1c-a1-m1-cY (length=70) [Search sequence]
GSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVN
KLAEIMNRKD
Structure information
PDB ID 1s1c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 77
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID X Y
UniProt accession Q13464 Q13464
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1s1c-a1-m1-cX_1s1c-a1-m1-cY.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1s1c-assembly1.cif.gz

[Back to Home]