1s3q/1/1:K/2:L

Sequences
>1s3q-a1-m1-cK (length=154) [Search sequence]
SISEKVEALNRQINAEIYSAYLYLSASYFDSIGLKGFSNWRVQWQEELHAKFDFVSERGG
RVKLYAVEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEAQEKDFATYNFLQWYVAEQV
EEEASALDIVEKLRLIGEDKRALLFLDKELSLRQ
>1s3q-a1-m2-cL (length=154) [Search sequence]
SISEKVEALNRQINAEIYSAYLYLSASYFDSIGLKGFSNWRVQWQEELHAKFDFVSERGG
RVKLYAVEEPPSEWDSPLAAFEHVYEHEVNVTKRIHELVEAQEKDFATYNFLQWYVAEQV
EEEASALDIVEKLRLIGEDKRALLFLDKELSLRQ
Structure information
PDB ID 1s3q (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 15837202
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID K L
UniProt accession O29424 O29424
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
Function annotation BioLiP:1s3qK BioLiP:1s3qL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1s3q-a1-m1-cK_1s3q-a1-m2-cL.pdb.gz
Full biological assembly
Download: 1s3q-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1s3q/1/1:A/1:H 1s3q/1/1:B/1:G 1s3q/1/1:C/2:J 1s3q/1/1:D/2:I 1s3q/1/1:E/2:F 1s3q/1/1:F/2:E 1s3q/1/1:I/2:D 1s3q/1/1:L/2:K 1s3q/1/2:A/2:H 1s3q/1/2:B/2:G 1s3q/1/2:C/1:J 1sq3/1/1:A/1:H 1sq3/1/1:B/1:G 1sq3/1/1:C/2:J 1sq3/1/1:D/2:I 1sq3/1/1:E/2:F 1sq3/1/1:F/2:E 1sq3/1/1:I/2:D 1sq3/1/1:J/2:C 1sq3/1/1:K/2:L 1sq3/1/1:L/2:K 1sq3/1/2:A/2:H 1sq3/1/2:B/2:G
Other dimers with similar sequences but different poses
  • 1s3q/1/2:K/2:L 1s3q/1/1:A/1:B 1s3q/1/1:C/1:D 1s3q/1/1:E/1:F 1s3q/1/1:H/1:G 1s3q/1/1:I/1:J 1s3q/1/1:K/1:L 1s3q/1/2:A/2:B 1s3q/1/2:C/2:D 1s3q/1/2:E/2:F 1s3q/1/2:H/2:G 1s3q/1/2:I/2:J 1sq3/1/1:A/1:B 1sq3/1/1:C/1:D 1sq3/1/1:E/1:F 1sq3/1/1:G/1:H 1sq3/1/1:I/1:J 1sq3/1/1:K/1:L 1sq3/1/2:A/2:B 1sq3/1/2:C/2:D 1sq3/1/2:E/2:F 1sq3/1/2:G/2:H 1sq3/1/2:I/2:J 1sq3/1/2:K/2:L
  • 1s3q/1/2:K/2:J 1s3q/1/1:A/1:D 1s3q/1/1:A/1:E 1s3q/1/1:D/1:E 1s3q/1/1:G/1:J 1s3q/1/1:K/1:G 1s3q/1/1:K/1:J 1s3q/1/2:A/2:D 1s3q/1/2:A/2:E 1s3q/1/2:D/2:E 1s3q/1/2:G/2:J 1s3q/1/2:K/2:G 1sq3/1/1:A/1:D 1sq3/1/1:A/1:E 1sq3/1/1:D/1:E 1sq3/1/1:G/1:J 1sq3/1/1:G/1:K 1sq3/1/1:J/1:K 1sq3/1/2:A/2:D 1sq3/1/2:A/2:E 1sq3/1/2:D/2:E 1sq3/1/2:G/2:J 1sq3/1/2:G/2:K 1sq3/1/2:J/2:K
  • 1s3q/1/2:L/2:G 1s3q/1/1:A/1:F 1s3q/1/1:B/1:D 1s3q/1/1:C/1:E 1s3q/1/1:H/1:J 1s3q/1/1:I/1:K 1s3q/1/1:L/1:G 1s3q/1/2:A/2:F 1s3q/1/2:B/2:D 1s3q/1/2:C/2:E 1s3q/1/2:H/2:J 1s3q/1/2:I/2:K 1sq3/1/1:A/1:F 1sq3/1/1:B/1:D 1sq3/1/1:C/1:E 1sq3/1/1:G/1:L 1sq3/1/1:H/1:J 1sq3/1/1:I/1:K 1sq3/1/2:A/2:F 1sq3/1/2:B/2:D 1sq3/1/2:C/2:E 1sq3/1/2:G/2:L 1sq3/1/2:H/2:J 1sq3/1/2:I/2:K
  • [Back to Home]