1s7g/1/1:A/1:B

Sequences

>1s7g-a1-m1-cA (length=252) [Search sequence]

MEDEIRKAAEILAKSKHAVVFTGAGISAESGIPTFRGEDGLWRKYDPEEVASISGFKRNP
RAFWEFSMEMKDKLFAEPNPAHYAIAELERMGIVKAVITQNIDMLHQRAGSRRVLELHGS
MDKLDCLDCHETYDWSEFVEDFNKGEIPRCRKCGSYYVKPRVVLFGEPLPQRTLFEAIEE
AKHCDAFMVVGSSLVVYPAAELPYIAKKAGAKMIIVNAEPTMADPIFDVKIIGKAGEVLP
KIVEEVKRLRSE

>1s7g-a1-m1-cB (length=252) [Search sequence]

Structure information

PDB ID	1s7g (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structural Basis for the Mechanism and Regulation of Sir2 Enzymes
Assembly ID	1
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	51
Sequence identity between the two chains	1.0
PubMed citation	15023335

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O30124	O30124
Species	2234 (Archaeoglobus fulgidus)	2234 (Archaeoglobus fulgidus)
Function annotation	BioLiP:1s7gA	BioLiP:1s7gB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1s7g-a1-m1-cA_1s7g-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1s7g-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1yc2/10/2:D/1:C 1yc2/6/1:A/1:B 1yc2/6/2:D/1:C 1yc2/9/1:A/1:B
Other dimers with similar sequences but different poses	1s7g/1/1:A/1:C 1yc2/6/1:A/1:C 1yc2/6/2:D/1:B 1yc2/7/1:A/1:C 1yc2/8/2:D/1:B