1sbz/1/3:B/3:D

Sequences
>1sbz-a1-m3-cB (length=165) [Search sequence]
KLIVGTGATGAPLGVALLQALREPNVETHLVSKWAKTTIELETPYSARDVAALADFSHNP
ADQAATISSGSFRTDGIVIPCSKTLAGIRAGYADGLVGRAADVVLKEGRKLVLVPREPLS
TIHLENLALSRGVAVPPPAFYNHPETVDDIVHHVVARVLDQFGLE
>1sbz-a1-m3-cD (length=174) [Search sequence]
KLIVGTGATGAPLGVALLQALREPNVETHLVSKWAKTTIELETPYSARDVAALADFSHNP
ADQAATISSGSFRTDGIVIPCSKTLAGIRAGYADGLVGRAADVVLKEGRKLVLVPREPLS
TIHLENLALSRGVAVPPPAFYNHPETVDDIVHHVVARVLDQFGLEHPYARRWQG
Structure information
PDB ID 1sbz (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of dodecameric FMN-dependent Ubix-like Decarboxylase from Escherichia coli O157:H7
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
PubMed citation 15459342
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID B D
UniProt accession P69772 P69772
Species 83334 (Escherichia coli O157:H7) 83334 (Escherichia coli O157:H7)
Function annotation BioLiP:1sbzB BioLiP:1sbzD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1sbz-a1-m3-cB_1sbz-a1-m3-cD.pdb.gz
Full biological assembly
Download: 1sbz-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1sbz/1/1:B/1:D 1sbz/1/1:C/1:A 1sbz/1/2:B/2:D 1sbz/1/2:C/2:A 1sbz/1/3:C/3:A
Other dimers with similar sequences but different poses
  • 1sbz/1/1:B/3:D 1sbz/1/1:A/2:A 1sbz/1/1:A/3:A 1sbz/1/2:A/3:A 1sbz/1/2:B/1:D 1sbz/1/3:B/2:D
  • 1sbz/1/2:B/3:B 1sbz/1/1:A/3:D 1sbz/1/1:B/2:B 1sbz/1/1:B/3:B 1sbz/1/1:C/1:D 1sbz/1/1:C/2:A 1sbz/1/2:A/1:D 1sbz/1/2:C/2:D 1sbz/1/2:C/3:A 1sbz/1/3:A/2:D 1sbz/1/3:C/1:A 1sbz/1/3:C/3:D
    		•

    [Back to Home]