1sfx/2/2:B/2:A

Sequences
>1sfx-a2-m2-cB (length=102) [Search sequence]
SNPLGELVKALEKLSFKPSDVRIYSLLLERGGRVSEIARELDLSARFVRDRLKVLLKRGF
VRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKFT
>1sfx-a2-m2-cA (length=106) [Search sequence]
HSNPLGELVKALEKLSFKPSDVRIYSLLLERGGRVSEIARELDLSARFVRDRLKVLLKRG
FVRREIVEKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKFTDGS
Structure information
PDB ID 1sfx (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
Assembly ID 2
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 82
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession O28271 O28271
Species 224325 (Archaeoglobus fulgidus DSM 4304) 224325 (Archaeoglobus fulgidus DSM 4304)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1sfx-a2-m2-cB_1sfx-a2-m2-cA.pdb.gz
Full biological assembly
Download: 1sfx-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1sfx/1/1:B/1:A 1sfx/2/1:B/1:A

[Back to Home]