1sj1/1/1:A/1:B

Sequences
>1sj1-a1-m1-cA (length=66) [Search sequence]
AWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSA
ITIEEA
>1sj1-a1-m1-cB (length=66) [Search sequence]
AWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPKVEVIEDEELYNCAKEAMEACPVSA
ITIEEA
Structure information
PDB ID 1sj1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title The 1.5 A Resolution Crystal Structure of [Fe3S4]-Ferredoxin from the hyperthermophilic Archaeon Pyrococcus furiosus
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 24
Sequence identity between the two chains 1.0
PubMed citation 15122884
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P29603 P29603
Species 2261 (Pyrococcus furiosus) 2261 (Pyrococcus furiosus)
Function annotation BioLiP:1sj1A BioLiP:1sj1B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1sj1-a1-m1-cA_1sj1-a1-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1sj1-assembly1.cif.gz
Similar dimers

[Back to Home]