1skv/1/1:B/1:A

Sequences
>1skv-a1-m1-cB (length=59) [Search sequence]
LEKELFELDEDVRELLSLIHEIKIDRITGNDKQKLGKAYFQVQKIEAELYQLIKVSHHH
>1skv-a1-m1-cA (length=62) [Search sequence]
SKEVLEKELFELDEDVRELLSLIHEIKIDRITGNDKQKLGKAYFQVQKIEAELYQLIKVS
HH
Structure information
PDB ID 1skv (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of D-63 from Sulfolobus Spindle Virus 1
Assembly ID 1
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 60
Sequence identity between the two chains 0.983
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P20215 P20215
Species 244589 (Sulfolobus spindle-shaped virus 1) 244589 (Sulfolobus spindle-shaped virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1skv-a1-m1-cB_1skv-a1-m1-cA.pdb.gz
Full biological assembly
Download: 1skv-assembly1.cif.gz

[Back to Home]