1sw7/1/1:A/1:B

Sequences

>1sw7-a1-m1-cA (length=245) [Search sequence]

RKFFVGGNWKMNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIGVAA
QNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEGLGV
IACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGNSSTPQQAQE
VHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEFVDI
INAKH

>1sw7-a1-m1-cB (length=245) [Search sequence]

Structure information

PDB ID	1sw7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Triosephosphate isomerase from Gallus gallus, loop 6 mutant K174N, T175S, A176S
Assembly ID	1
Resolution	2.22Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	129
Sequence identity between the two chains	1.0
PubMed citation	15166315

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P00940	P00940
Species	9031 (Gallus gallus)	9031 (Gallus gallus)
Function annotation	BioLiP:1sw7A	BioLiP:1sw7B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1sw7-a1-m1-cA_1sw7-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1sw7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1spq/1/1:B/1:A 1sq7/1/1:A/1:B 1ssd/1/1:A/1:B 1ssd/2/1:A/1:B 1ssd/2/2:A/2:B 1ssg/1/1:A/1:B 1su5/1/1:A/1:B 1sw0/1/1:A/1:B 1sw3/1/1:A/1:B 1tim/1/1:A/1:B 1tpb/1/1:1/1:2 1tpc/1/1:1/1:2 1tph/1/1:1/1:2 1tpu/1/1:A/1:B 1tpv/1/1:A/1:B 1tpw/1/1:A/1:B 4p61/1/1:B/1:A 8tim/1/1:A/1:B