1t0z/7/3:A/3:B

Sequences
>1t0z-a7-m3-cA (length=72) [Search sequence]
KKNGYAVDSSGKVAECLFNNYCNNECTKVYYADKGYCCLLKCYCFGLADDKPVLDIWDST
KNYCDVQIIDLS
>1t0z-a7-m3-cB (length=72) [Search sequence]
KKNGYAVDSSGKVAECLFNNYCNNECTKVYYADKGYCCLLKCYCFGLADDKPVLDIWDST
KNYCDVQIIDLS
Structure information
PDB ID 1t0z (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of an Excitatory Insect-specific Toxin with an Analgesic Effect on Mammalian from Scorpion Buthus martensii Karsch
Assembly ID 7
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 18
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 3
Chain ID A B
UniProt accession O77091 O77091
Species 34649 (Mesobuthus martensii) 34649 (Mesobuthus martensii)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1t0z-a7-m3-cA_1t0z-a7-m3-cB.pdb.gz
Full biological assembly
Download: 1t0z-assembly7.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1t0z/3/1:A/1:B 1t0z/3/2:A/2:B 1t0z/3/3:A/3:B 1t0z/3/4:A/4:B 1t0z/7/1:A/1:B
Other dimers with similar sequences but different poses
  • 1t0z/8/1:A/3:B 1t0z/3/1:A/3:B 1t0z/3/1:B/3:A 1t0z/3/2:A/4:B 1t0z/3/2:B/4:A 1t0z/4/1:A/3:B 1t0z/4/2:A/4:B 1t0z/5/1:A/3:B 1t0z/5/5:A/6:B 1t0z/7/1:A/3:B 1t0z/7/1:B/3:A
  • 1t0z/9/1:A/5:A 1t0z/5/1:A/5:A 1t0z/6/1:A/5:A
    		•

    [Back to Home]