1t4a/1/2:A/2:B

Sequences
>1t4a-a1-m2-cA (length=76) [Search sequence]
YKVKVYVSLKESVLDPQGSAVQHALHSTYNEVQDVRIGKYELTIEKSDRDLDVLVKECEK
LLANTVIEDYRYEVEE
>1t4a-a1-m2-cB (length=76) [Search sequence]
YKVKVYVSLKESVLDPQGSAVQHALHSTYNEVQDVRIGKYELTIEKSDRDLDVLVKECEK
LLANTVIEDYRYEVEE
Structure information
PDB ID 1t4a (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of B. Subtilis PurS C2 Crystal Form
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 74
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P12049 P12049
Species 1423 (Bacillus subtilis) 1423 (Bacillus subtilis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1t4a-a1-m2-cA_1t4a-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1t4a-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1t4a/1/1:A/1:B 1twj/1/1:A/1:B 1twj/1/1:C/1:D
Other dimers with similar sequences but different poses
  • 1twj/1/1:A/1:D 1twj/1/1:C/1:B
  • [Back to Home]