1tbx/2/2:B/1:A

Sequences
>1tbx-a2-m2-cB (length=89) [Search sequence]
KSTPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPSTATFYDAKKFLIQEGFVKERQER
GEKRLYLTEKGKLFAISLKTAIETYKQIK
>1tbx-a2-m1-cA (length=93) [Search sequence]
STPFFYPEAIVLAYLYDNEGIATYDLYKKVNAEFPSTATFYDAKKFLIQEGFVKERQERG
EKRLYLTEKGKLFAISLKTAIETYKQIKKRHHH
Structure information
PDB ID 1tbx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SSV1 F-93
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID B A
UniProt accession P20222 P20222
Species 244589 (Sulfolobus spindle-shaped virus 1) 244589 (Sulfolobus spindle-shaped virus 1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1tbx-a2-m2-cB_1tbx-a2-m1-cA.pdb.gz
Full biological assembly
Download: 1tbx-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1tbx/2/2:B/2:A 1tbx/1/1:B/1:A 1tbx/2/1:B/1:A
  • [Back to Home]