1td0/3/4:C/5:C

Sequences

>1td0-a3-m4-cC (length=101) [Search sequence]

VRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGT ETALTYYKSGTFATEAIHWPESVDEHKKANAFAGSALSHAA

>1td0-a3-m5-cC (length=101) [Search sequence]

VRIFAGNDPAHTATGSSGISSPTPALTPLMLDEATGKLVVWDGQKAGSAVGILVLPLEGT ETALTYYKSGTFATEAIHWPESVDEHKKANAFAGSALSHAA

Structure information

PDB ID	1td0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Viral capsid protein SHP at pH 5.5
Assembly ID	3
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	58
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	5
Chain ID	C	C
UniProt accession	P36275	P36275
Species	10711 (Enterobacteria phage P21)	10711 (Enterobacteria phage P21)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1td0-a3-m4-cC_1td0-a3-m5-cC.pdb.gz

Full biological assembly Download: 1td0-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1td0/1/1:A/2:A 1td0/1/1:A/3:A 1td0/1/2:A/3:A 1td0/2/1:B/4:B 1td0/2/1:B/5:B 1td0/2/4:B/5:B 1td0/3/1:C/4:C 1td0/3/1:C/5:C 1td0/4/1:D/6:D 1td0/4/1:D/7:D 1td0/4/6:D/7:D 1td3/1/1:A/1:B 1td3/1/1:A/1:C 1td3/1/1:B/1:C 1td4/1/1:A/2:A 1td4/1/1:A/3:A 1td4/1/2:A/3:A