1te2/1/1:A/1:B

Sequences

>1te2-a1-m1-cA (length=211) [Search sequence]

RQILAAIFDDGLLIDSEPLWDRAELDVASLGVDISRRNELPDTLGLRIDVVDLWYARQPW
NGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHLEKVLTF
DLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGIASKAARRSIVV
PAPEAQNDPRFVLANVKLSSLTELTAKDLLG

>1te2-a1-m1-cB (length=211) [Search sequence]

Structure information

PDB ID	1te2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Putative Phosphatase Ynic from Escherichia coli K12
Assembly ID	1
Resolution	1.76Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	40
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P77247	P77247
Species	83333 (Escherichia coli K-12)	83333 (Escherichia coli K-12)
Function annotation	BioLiP:1te2A	BioLiP:1te2B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1te2-a1-m1-cA_1te2-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1te2-assembly1.cif.gz