1th7/1/1:F/1:N

Sequences
>1th7-a1-m1-cF (length=78) [Search sequence]
GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGK
KLGTIVIRGDNVILISPL
>1th7-a1-m1-cN (length=78) [Search sequence]
GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGK
KLGTIVIRGDNVILISPL
Structure information
PDB ID 1th7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
Assembly ID 1
Resolution 1.68Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F N
UniProt accession Q97ZQ0 Q97ZQ0
Species 2287 (Saccharolobus solfataricus) 2287 (Saccharolobus solfataricus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1th7-a1-m1-cF_1th7-a1-m1-cN.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1th7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1th7/1/1:A/1:L 1th7/1/1:B/1:K 1th7/1/1:C/1:J 1th7/1/1:D/1:I 1th7/1/1:E/1:H 1th7/1/1:G/1:M
Other dimers with similar sequences but different poses
  • 1th7/1/1:H/1:N 1th7/1/1:A/1:B 1th7/1/1:A/1:G 1th7/1/1:B/1:C 1th7/1/1:C/1:D 1th7/1/1:D/1:E 1th7/1/1:E/1:F 1th7/1/1:F/1:G 1th7/1/1:H/1:I 1th7/1/1:I/1:J 1th7/1/1:J/1:K 1th7/1/1:K/1:L 1th7/1/1:L/1:M 1th7/1/1:M/1:N
  • [Back to Home]