1th7/1/1:H/1:N

Sequences

>1th7-a1-m1-cH (length=78) [Search sequence]

GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGK KLGTIVIRGDNVILISPL

>1th7-a1-m1-cN (length=78) [Search sequence]

GAMNFLAETAHKVLAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDGSGK KLGTIVIRGDNVILISPL

Structure information

PDB ID	1th7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of an Archaeal Sm Protein from Sulfolobus solfataricus
Assembly ID	1
Resolution	1.68Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	H	N
UniProt accession	Q97ZQ0	Q97ZQ0
Species	2287 (Saccharolobus solfataricus)	2287 (Saccharolobus solfataricus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1th7-a1-m1-cH_1th7-a1-m1-cN.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1th7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1th7/1/1:A/1:B 1th7/1/1:A/1:G 1th7/1/1:B/1:C 1th7/1/1:C/1:D 1th7/1/1:D/1:E 1th7/1/1:E/1:F 1th7/1/1:F/1:G 1th7/1/1:H/1:I 1th7/1/1:I/1:J 1th7/1/1:J/1:K 1th7/1/1:K/1:L 1th7/1/1:L/1:M 1th7/1/1:M/1:N
Other dimers with similar sequences but different poses	1th7/1/1:F/1:N 1th7/1/1:A/1:L 1th7/1/1:B/1:K 1th7/1/1:C/1:J 1th7/1/1:D/1:I 1th7/1/1:E/1:H 1th7/1/1:G/1:M