1til/1/1:A/1:C

Sequences
>1til-a1-m1-cA (length=141) [Search sequence]
MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIIHGYNNDP
NGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKPELERSGMGFTIMENFMDEV
IVESEVNKGTTVYLKKHIVKS
>1til-a1-m1-cC (length=141) [Search sequence]
MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIKTVVSEAVTNAIIHGYNNDP
NGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKPELERSGMGFTIMENFMDEV
IVESEVNKGTTVYLKKHIVKS
Structure information
PDB ID 1til (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA:Poised for phosphorylation complex with ATP, crystal form II
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
PubMed citation 15236958
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A C
UniProt accession O32727 O32727
Species 1422 (Geobacillus stearothermophilus) 1422 (Geobacillus stearothermophilus)
Function annotation BioLiP:1tilA BioLiP:1tilC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1til-a1-m1-cA_1til-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 1til-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1l0o/1/1:A/1:B 1th8/1/1:A/2:A 1thn/1/1:A/1:C 1tid/1/1:C/1:A 1til/2/1:E/2:E

[Back to Home]