1tlu/1/1:A/1:B

Sequences
>1tlu-a1-m1-cA (length=117) [Search sequence]
KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS
ESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI
>1tlu-a1-m1-cB (length=117) [Search sequence]
KSLGRHLVAEFYECDREVLDNVQLIEQEMKQAAYESGATIVTSTFHRFLPYGVSGVVVIS
ESHLTIHTWPEYGYAAIDLFTCGEDVDPWKAFEHLKKALKAKRVHVVEHERGRYDEI
Structure information
PDB ID 1tlu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Thermotoga maritima S-adenosylmethionine decarboxylase
Assembly ID 1
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 108
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9WZC3 Q9WZC3
Species 2336 (Thermotoga maritima) 2336 (Thermotoga maritima)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1tlu-a1-m1-cA_1tlu-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1tlu-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1tmi/1/1:A/1:B 1vr7/1/1:B/1:A 3iwb/1/1:A/1:C 3iwc/1/1:C/1:A 3iwd/1/1:A/1:C
Other dimers with similar sequences but different poses
  • 3iwd/1/1:B/1:D 3iwb/1/1:B/1:D 3iwc/1/1:B/1:D
  • [Back to Home]