1tp5/2/1:A/2:A

Sequences
>1tp5-a2-m1-cA (length=115) [Search sequence]
FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
>1tp5-a2-m2-cA (length=115) [Search sequence]
FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQIL
SVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Structure information
PDB ID 1tp5 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of PDZ3 domain of PSD-95 protein complexed with a peptide ligand KKETWV
Assembly ID 2
Resolution 1.54Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P31016 P31016
Species 10116 (Rattus norvegicus) 10116 (Rattus norvegicus)
Function annotation BioLiP:1tp5A BioLiP:1tp5A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1tp5-a2-m1-cA_1tp5-a2-m2-cA.pdb.gz
Full biological assembly
Download: 1tp5-assembly2.cif.gz

[Back to Home]