1tqj/1/1:A/1:F

Sequences

>1tqj-a1-m1-cA (length=217) [Search sequence]

KNIVVAPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVDAIRPLTK
KTLDVHLMIVEPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLNPS
TPLDFLEYVLPVCDLILIMSVNPQSFIPEVLPKIRALRQMCDERGLDPWIEVDGGLKPNN
TWQVLEAGANAIVAGSAVFNAPNYAEAIAGVRNSKRP

>1tqj-a1-m1-cF (length=217) [Search sequence]

Structure information

PDB ID	1tqj (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of D-ribulose 5-phosphate 3-epimerase from Synechocystis to 1.6 angstrom resolution
Assembly ID	1
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	81
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	F
UniProt accession	P74061	P74061
Species	1143 (Synechocystis sp.)	1143 (Synechocystis sp.)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1tqj-a1-m1-cA_1tqj-a1-m1-cF.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1tqj-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1tqj/1/1:B/1:E 1tqj/1/1:D/1:C
Other dimers with similar sequences but different poses	1tqj/1/1:A/1:C 1tqj/1/1:B/1:D 1tqj/1/1:B/1:F 1tqj/1/1:D/1:F 1tqj/1/1:E/1:A 1tqj/1/1:E/1:C