1tr0/2/1:W/1:Y

Sequences
>1tr0-a2-m1-cW (length=106) [Search sequence]
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRG
YTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
>1tr0-a2-m1-cY (length=106) [Search sequence]
TRTPKLVKHTLLTRFKDEITREQIDNYINDYTNLLDLIPSMKSFNWGTDLGMESAELNRG
YTHAFESTFESKSGLQEYLDSAALAAFAEGFLPTLSQRLVIDYFLY
Structure information
PDB ID 1tr0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of a boiling stable protein SP1
Assembly ID 2
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 25
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID W Y
UniProt accession Q9AR79 Q9AR79
Species 113636 (Populus tremula) 113636 (Populus tremula)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1tr0-a2-m1-cW_1tr0-a2-m1-cY.pdb.gz
Full biological assembly
Download: 1tr0-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1si9/2/1:A/4:C 1si9/2/1:A/6:B 1si9/2/1:C/4:A 1si9/2/1:C/5:B 1si9/2/2:A/3:C 1si9/2/2:A/5:B 1si9/2/2:C/3:A 1si9/2/2:C/6:B 1si9/2/3:A/7:B 1si9/2/3:C/8:B 1si9/2/4:A/8:B 1si9/2/4:C/7:B 1tr0/1/1:A/1:C 1tr0/1/1:A/1:K 1tr0/1/1:B/1:D 1tr0/1/1:B/1:L 1tr0/1/1:C/1:E 1tr0/1/1:D/1:F 1tr0/1/1:E/1:G 1tr0/1/1:F/1:H 1tr0/1/1:G/1:I 1tr0/1/1:H/1:J 1tr0/1/1:I/1:K 1tr0/1/1:J/1:L 1tr0/2/1:M/1:O 1tr0/2/1:M/1:X 1tr0/2/1:N/1:P 1tr0/2/1:N/1:Y 1tr0/2/1:O/1:R 1tr0/2/1:P/1:S 1tr0/2/1:R/1:T 1tr0/2/1:S/1:U 1tr0/2/1:T/1:V 1tr0/2/1:U/1:W 1tr0/2/1:V/1:X
Other dimers with similar sequences but different poses
  • 1tr0/2/1:X/1:Y 1si9/1/1:A/1:C 1si9/2/1:A/1:C 1si9/2/2:A/2:C 1si9/2/3:A/3:C 1si9/2/4:A/4:C 1si9/2/5:B/6:B 1si9/2/7:B/8:B 1si9/3/1:A/1:C 1si9/4/1:B/9:B 1tr0/1/1:A/1:B 1tr0/1/1:C/1:D 1tr0/1/1:E/1:F 1tr0/1/1:G/1:H 1tr0/1/1:I/1:J 1tr0/1/1:K/1:L 1tr0/2/1:M/1:N 1tr0/2/1:O/1:P 1tr0/2/1:R/1:S 1tr0/2/1:T/1:U 1tr0/2/1:V/1:W
  • 1tr0/2/1:M/1:Y 1si9/2/1:A/4:A 1si9/2/1:C/6:B 1si9/2/2:A/3:A 1si9/2/2:C/5:B 1si9/2/3:C/7:B 1si9/2/4:C/8:B 1tr0/1/1:A/1:L 1tr0/1/1:B/1:C 1tr0/1/1:D/1:E 1tr0/1/1:F/1:G 1tr0/1/1:H/1:I 1tr0/1/1:J/1:K 1tr0/2/1:N/1:O 1tr0/2/1:P/1:R 1tr0/2/1:S/1:T 1tr0/2/1:U/1:V 1tr0/2/1:W/1:X
  • [Back to Home]