1ttw/1/1:A/2:A

Sequences

>1ttw-a1-m1-cA (length=118) [Search sequence]

TYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQ LYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLS

>1ttw-a1-m2-cA (length=118) [Search sequence]

TYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQ LYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLS

Structure information

PDB ID	1ttw (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Yersinia Pestis type III secretion chaperone SycH in complex with a stable fragment of YscM2
Assembly ID	1
Resolution	2.38Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	55
Sequence identity between the two chains	1.0
PubMed citation	15333930

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	Q7BTX0	Q7BTX0
Species	214092 (Yersinia pestis CO92)	214092 (Yersinia pestis CO92)
Function annotation	BioLiP:1ttwA	BioLiP:1ttwA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ttw-a1-m1-cA_1ttw-a1-m2-cA.pdb.gz

Full biological assembly Download: 1ttw-assembly1.cif.gz