1u5d/8/1:C/7:D

Sequences
>1u5d-a8-m1-cC (length=107) [Search sequence]
GSVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYSVRMA
PHLRRDSKKESCFELTSQDRRTYEFTATSPAEARDWVDQISFLLKDL
>1u5d-a8-m7-cD (length=108) [Search sequence]
GSVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYSVRMA
PHLRRDSKKESCFELTSQDRRTYEFTATSPAEARDWVDQISFLLKDLS
Structure information
PDB ID 1u5d (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the PH domain of SKAP55
Assembly ID 8
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 71
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 7
Chain ID C D
UniProt accession Q86WV1 Q86WV1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1u5d-a8-m1-cC_1u5d-a8-m7-cD.pdb.gz
Full biological assembly
Download: 1u5d-assembly8.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1u5d/5/2:B/1:A 1u5d/5/3:C/4:D 1u5d/6/2:B/1:A 1u5d/6/5:C/6:D 1u5d/7/2:B/1:A

[Back to Home]