1u9d/3/4:B/5:B

Sequences

>1u9d-a3-m4-cB (length=120) [Search sequence]

GVDLGTENLYFSSNAPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYF AEGGVYPVEVLWFGREQQTQDQIAQVITDQIRQLLGADSHLAVVFIPLQRTAYYLDGQHF

>1u9d-a3-m5-cB (length=120) [Search sequence]

GVDLGTENLYFSSNAPHLRFRAVEAHIVESLVPTLLNELSSLLSTARNAFTFELINTQYF AEGGVYPVEVLWFGREQQTQDQIAQVITDQIRQLLGADSHLAVVFIPLQRTAYYLDGQHF

Structure information

PDB ID	1u9d (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Protein of Unknown Function from Vibrio cholerae O1 biovar eltor str. N16961
Assembly ID	3
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	65
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	4	5
Chain ID	B	B
UniProt accession	Q9KU16	Q9KU16
Species	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)	243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1u9d-a3-m4-cB_1u9d-a3-m5-cB.pdb.gz

Full biological assembly Download: 1u9d-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

1u9d/2/1:A/2:A 1u9d/2/1:A/3:A 1u9d/2/2:A/3:A 1u9d/3/1:B/4:B 1u9d/3/1:B/5:B