1ub3/1/1:C/1:D

Sequences

>1ub3-a1-m1-cC (length=210) [Search sequence]

DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPSYVAWVRARYPHAPFRLVTVV
GFPLGYQEKEVKALEAALACARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVL
KVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGASLEDVALLVRVAQGRAQVKA
AGGIRDRETALRMLKAGASRLGTSSGVALV

>1ub3-a1-m1-cD (length=211) [Search sequence]

Structure information

PDB ID	1ub3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	53
Sequence identity between the two chains	1.0
PubMed citation	15388928

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q5SJ28	Q5SJ28
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)
Function annotation	BioLiP:1ub3C	BioLiP:1ub3D

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1ub3-a1-m1-cC_1ub3-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1ub3-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1j2w/1/1:B/1:A 1j2w/1/1:D/1:C 1ub3/1/1:A/1:B
Other dimers with similar sequences but different poses	1ub3/1/1:B/1:D 1j2w/1/1:A/1:C 1j2w/1/1:D/1:B 1ub3/1/1:C/1:A