1ucr/1/1:A/1:B

Sequences

>1ucr-a1-m1-cA (length=74) [Search sequence]

MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGST TMYGLKGAGKQAAA

>1ucr-a1-m1-cB (length=75) [Search sequence]

MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGST TMYGLKGAGKQAAAE

Structure information

PDB ID	1ucr (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Three-dimensional crystal structure of dissimilatory sulfite reductase D (DsrD)
Assembly ID	1
Resolution	1.2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	61
Sequence identity between the two chains	1.0
PubMed citation	12962631

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q46582	Q46582
Species	881 (Desulfovibrio vulgaris)	881 (Desulfovibrio vulgaris)
Function annotation	BioLiP:1ucrA	BioLiP:1ucrB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 1ucr-a1-m1-cA_1ucr-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 1ucr-assembly1.cif.gz