1ue1/1/1:B/2:B

Sequences
>1ue1-a1-m1-cB (length=119) [Search sequence]
AGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEWKDGEALFLRCNIWR
EAAENVAESLTRGARVIVSGRLKQRSFETRKRTVIEVEVDEIGPSLRYATAKVNKASRS
>1ue1-a1-m2-cB (length=119) [Search sequence]
AGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTGEWKDGEALFLRCNIWR
EAAENVAESLTRGARVIVSGRLKQRSFETRKRTVIEVEVDEIGPSLRYATAKVNKASRS
Structure information
PDB ID 1ue1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 58
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P9WGD5 P9WGD5
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ue1-a1-m1-cB_1ue1-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1ue1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1x3f/1/1:B/2:B 1x3g/1/1:B/2:B 7f5y/1/1:A/2:B
Other dimers with similar sequences but different poses
  • 7f5y/1/2:A/2:B 1ue6/2/1:D/3:D 7f5y/1/1:A/1:B
  • [Back to Home]