1uf3/1/1:E/1:H

Sequences

>1uf3-a1-m1-cE (length=222) [Search sequence]

RRTVRYILATSNPGDLEALEKFVKLAPDTGADAIALIGNLPKAAKSRDYAAFFRILSEAH
LPTAYVPGPQDAPIWEYLREAANVELVHPERNVHETFTFWRGPYLVAGVGGEIADEGEPE
EHEALRYPAWVAEYRLKALWELKDYPKIFLFHTPYHKGLNEQGSHEVAHLIKTHNPLLVL
VAGKGQKHELGASWVVVPGDLSEGEYSLLDLRARKLETGNVR

>1uf3-a1-m1-cH (length=222) [Search sequence]

Structure information

PDB ID	1uf3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of TT1561 of thermus thermophilus HB8
Assembly ID	1
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	P84068	P84068
Species	274 (Thermus thermophilus)	274 (Thermus thermophilus)
Function annotation	BioLiP:1uf3E	BioLiP:1uf3H

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1uf3-a1-m1-cE_1uf3-a1-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1uf3-assembly1.cif.gz