1ufi/3/1:D/1:C

Sequences
>1ufi-a3-m1-cD (length=46) [Search sequence]
HMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTR
>1ufi-a3-m1-cC (length=48) [Search sequence]
SHMPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRK
Structure information
PDB ID 1ufi (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the dimerization domain of human CENP-B
Assembly ID 3
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 85
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P07199 P07199
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1ufi-a3-m1-cD_1ufi-a3-m1-cC.pdb.gz
Full biological assembly
Download: 1ufi-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1ufi/1/1:B/1:A 1ufi/2/1:D/1:C 1ufi/3/1:B/1:A

[Back to Home]